Recombinant Mouse Neuromedin-B receptor(Nmbr)

Volume: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Mus musculus (Mouse) Uniprot NO.: O54799 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MPPRSLSNLSFPTEANESELVPEVWEKDFLPDSDGTTAELVIRCVIPSLYLIIISVGLLG NIMLVKIFLTNSAMRNVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIP AIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGVLLWTSLKAVGIWVVSVLLAVPEAV FSEVARIGSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLI KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFVFCWFPNHVLYLYRSFNYKEIDPSL GHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGRKSYPERSTSYLLSSSAV RMTSLKSNTKNVVTNSVLLNGHSTKQEIAL Protein Names: Recommended name: Neuromedin-B receptor Short name= NMB-R Alternative name(s): Neuromedin-B-preferring bombesin receptor Gene Names: Name: Nmbr Expression Region: 1-390 Sequence Info: Full length protein