Recombinant Thiobacillus ferrooxidans Mercuric resistance protein merC(merC)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Thiobacillus ferrooxidans (Acidithiobacillus ferrooxidans) Uniprot NO.: P22905 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MSAITRIIDKIGIVGTIVGSFSCAMCFPAAASLGAAIGLGFLSQWEGLFVQWLIPIFASV ALLATLAGWFSHRQWQRTLLGSIGPVLALVGVFGLTHHFLDKDLARVIFYTGLVVMFLVS IWDMVNPANRRCATDGCETPAPRS Protein Names: Recommended name: Mercuric resistance protein merC Gene Names: Name: merC Expression Region: 1-144 Sequence Info: full length protein