Recombinant Kluyveromyces lactis Protein YOP1(YOP1)

Volume: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) Uniprot NO.: Q6CP93 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MADYLKLFQDSLKGLDTKFAGNQILSRIEAQTKLPRSYVIVGLVAVYFLLIFINVGGIGE ILSNFVGFCIPTYYSLKALKTATSTDDTQLLTYWIVFSFLSVIEFWSKAILYWVPFYWFF KTVFLLYIAIPSFGGAQLVYTRLISPFSDKYLPIVEGKSGELAQKVEAAANNAKASGYSR Protein Names: Recommended name: Protein YOP1 Gene Names: Name: YOP1 Ordered Locus Names: KLLA0E06578g Expression Region: 1-180 Sequence Info: full length protein