Recombinant Sulfoxide reductase heme-binding subunit YedZ(yedZ)

Volume: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Yersinia pestis Uniprot NO.: Q8ZAX0 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLL VSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTL GIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIYA VMAALLLLLRYKLLLPRYKKFRQWFR Protein Names: Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ Gene Names: Name: yedZ Ordered Locus Names: YPO3661, y0206, YP_3885 Expression Region: 1-206 Sequence Info: full length protein