Skip to Content

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 1(PCR1)

https://www.computablegenomix.com/web/image/product.template/117038/image_1920?unique=59ef7fb
Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.: Q9LQU2 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MEAQLHAKPHAQGEWSTGFCDCFSDCRNCCITLCCPCITFGQVAEIVDRGSKSCCAAGAL YMLIDLITSCGRMYACFYSGKMRAQYNIKGDGCTDCLKHFCCNLCALTQQYRELKHRGFD MSLGWAGNAEKQQNQGGVAMGAPAFQGGMTR Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 1 Short name= AtPCR1 Gene Names: Name: PCR1 Ordered Locus Names: At1g14880 ORF Names: F10B6.29 Expression Region: 1-151 Sequence Info: full length protein

1,075.68 1075.68 USD 1,075.68

1,075.68

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days