Skip to Content

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 12(PCR12)

https://www.computablegenomix.com/web/image/product.template/117041/image_1920?unique=59ef7fb
Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.: Q9SX26 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MYGNGPVFKAEGTSFRDQPYAEQLPQGLWTTGLCDCHEDAHICVQTAIMPCVSFAQNVEI VNRGTIPCMNAGLIHLALGFIGCSWLYAFPNRSRLREHFALPEEPCRDFLVHLFCTPCAI CQESRELKNRGADPSIGWLSNVEKWSREKVTPPIVVPGMIR Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 12 Short name= AtPCR12 Gene Names: Name: PCR12 Ordered Locus Names: At1g68630 ORF Names: F24J5.13 Expression Region: 1-161 Sequence Info: full length protein

1,083.60 1083.6 USD 1,083.60

1,083.60

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days